Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Cold-inducible RNA-binding protein |
|---|
Gene and Protein Information
| Gene ID | 1153 |
|---|---|
| Uniprot Accession IDs | Q14011 B3KT17 B4E2X2 |
| Ensembl ID | ENSP00000466897 |
| Symbol | A18HNRNP CIRP CIRP |
| Sequence | MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 706175 | CIRBP | cold inducible RNA binding protein | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12696 | Cirbp | cold inducible RNA binding protein | 10090 | MGI:893588 | Inparanoid, OMA, EggNOG |
| Rat | 81825 | Cirbp | cold inducible RNA binding protein | 10116 | RGD:620756 | Inparanoid, OMA, EggNOG |
| Dog | 476755 | CIRBP | cold inducible RNA binding protein | 9615 | VGNC:54590 | Inparanoid, OMA, EggNOG |
| Cow | 507120 | CIRBP | cold inducible RNA binding protein | 9913 | VGNC:52752 | Inparanoid, OMA, EggNOG |
| Pig | 100522851 | CIRBP | cold inducible RNA binding protein | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | CIRBP | cold inducible RNA binding protein [Source:HGNC Symbol;Acc:HGNC:1982] | 13616 | Inparanoid, OMA, EggNOG | ||
| Platypus | 100087691 | LOC100087691 | cold-inducible RNA-binding protein | 9258 | OMA, EggNOG | |
| Anole lizard | 100552626 | cirbp | cold inducible RNA binding protein | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549982 | cirbp | cold inducible RNA binding protein | 8364 | XB-GENE-492781 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / mRNA splicing factor / Cold-inducible RNA-binding protein
protein / nucleic acid binding / mRNA splicing factor / Cold-inducible RNA-binding protein
DTO Classes
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / Cold-inducible RNA-binding protein
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / Cold-inducible RNA-binding protein
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.