224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Arginyl-tRNA--protein transferase 1 |
|---|
Gene and Protein Information
| Gene ID | 11101 |
|---|---|
| Uniprot Accession IDs | O95260 O95261 Q5SQQ3 Q8WW04 Arginyltransferase 1 |
| Ensembl ID | ENSP00000224652 |
| Family | Belongs to the R-transferase family. |
| Sequence | MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQTCCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTMDDAVAGDFALINKLDIQCDLKTLSDDIKESLESEGKNSKKEEPQELLQSQDFVGEKLGSGEPSHSVKVHTVPKPGKGADLSKPPCRKAKEIRKERKRLKLMQQNPAGELEGFQAQGHPPSLFPPKAKSNQPKSLEDLIFESLPENASHKLEVRVVRSSPPSSQFKATLLESYQVYKRYQMVIHKNPPDTPTESQFTRFLCSSPLEAETPPNGPDCGYGSFHQQYWLDGKIIAVGVIDILPNCVSSVYLYYDPDYSFLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMKYKGQYRPSDLLCPETYVWVPIEQCLPSLENSKYCRFNQDPEAVDEDRSTEPDRLQVFHKRAIMPYGVYKKQQKDPSEEAAVLQYASLVGQKCSERMLLFRN Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450786 | ATE1 | arginyltransferase 1 | 9598 | VGNC:51966 | OMA, EggNOG |
| Macaque | 705248 | ATE1 | arginyltransferase 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 11907 | Ate1 | arginyltransferase 1 | 10090 | MGI:1333870 | Inparanoid, OMA, EggNOG |
| Rat | 293526 | Ate1 | arginyltransferase 1 | 10116 | RGD:1309335 | Inparanoid, OMA, EggNOG |
| Dog | 486919 | ATE1 | arginyltransferase 1 | 9615 | VGNC:38206 | Inparanoid, OMA, EggNOG |
| Horse | 100064881 | ATE1 | arginyltransferase 1 | 9796 | VGNC:15608 | Inparanoid, OMA, EggNOG |
| Cow | 534601 | ATE1 | arginyltransferase 1 | 9913 | VGNC:26238 | Inparanoid, OMA, EggNOG |
| Pig | 100512816 | ATE1 | arginyltransferase 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100025687 | ATE1 | arginyltransferase 1 | 13616 | Inparanoid, EggNOG | |
| Chicken | 423936 | ATE1 | arginyltransferase 1 | 9031 | CGNC:7230 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100562215 | ate1 | arginyltransferase 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100495601 | ate1 | arginyltransferase 1 | 8364 | XB-GENE-961934 | Inparanoid, OMA, EggNOG |
| C. elegans | 172800 | ate-1 | Arginyl-tRNA--protein transferase 1 | 6239 | OMA, EggNOG | |
| Fruitfly | 37288 | Ate1 | CG9204 gene product from transcript CG9204-RA | 7227 | FBgn0025720 | Inparanoid, EggNOG |
| S.cerevisiae | 852867 | ATE1 | arginyltransferase | 4932 | S000002985 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.