🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

ACTR3

DescripciónActin-related protein 3

Gene and Protein Information

Gene ID10096
Uniprot Accession IDs P61158 P32391 Q53QM2
Ensembl ID ENSP00000263238
Symbol ARP3 ARP3
FamilyBelongs to the actin family. ARP3 subfamily.
Sequence
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque709836ACTR3ARP3 actin related protein 3 homolog9544Inparanoid, OMA, EggNOG
Mouse74117Actr3ARP3 actin-related protein 310090MGI:1921367Inparanoid, OMA, EggNOG
Rat81732Actr3ARP3 actin related protein 3 homolog10116RGD:71024Inparanoid, OMA, EggNOG
Dog475549ACTR3BARP3 actin related protein 3 homolog B9615VGNC:49707Inparanoid, EggNOG
Horse100033909ACTR3ARP3 actin related protein 3 homolog9796VGNC:49331Inparanoid, OMA
Cow281597ACTR3ARP3 actin related protein 3 homolog9913VGNC:50033Inparanoid, OMA
Pig396738ACTR3ARP3 actin related protein 3 homolog9823Inparanoid, OMA, EggNOG
OpossumACTR3ARP3 actin related protein 3 homolog [Source:HGNC Symbol;Acc:HGNC:170]13616Inparanoid, OMA, EggNOG
Chicken374197ACTR3ARP3 actin related protein 3 homolog9031CGNC:49080Inparanoid, OMA, EggNOG
Anole lizard100559108actr3ARP3 actin related protein 3 homolog28377Inparanoid, OMA, EggNOG
Xenopus394999actr3ARP3 actin-related protein 3 homolog8364XB-GENE-5915063OMA, EggNOG
C. elegans171857arx-1Actin-related protein 36239OMA, EggNOG
Fruitfly38898Arp3Actin-related protein 37227FBgn0262716OMA, EggNOG
S.cerevisiae853528ARP3actin-related protein 34932S000003826OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    cytoskeletal protein    /    actin and actin related protein    /    Actin-related protein 3
DTO Classes
protein    /    Cellular structure    /    Actin family cytoskeletal protein    /    Actin and actin related protein    /    Actin-related protein 3

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.