🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CMTM5

DescripciónCKLF-like MARVEL transmembrane domain-containing protein 5

Gene and Protein Information

Gene ID116173
Uniprot Accession IDs Q96DZ9 E9PH91 Q5PY48
Ensembl ID ENSP00000344819
Symbol CKLFSF5 CKLFSF5
FamilyBelongs to the chemokine-like factor family.
Sequence
MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRINWPCLLQGHGQSGGPHPLDLLSHSAKVQPQPWPGLTPPGWHTPAAVPWVPAPAPGFWSWLLWFICFHSLGSSDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp743982CMTM5CKLF like MARVEL transmembrane domain containing 59598VGNC:13038Inparanoid, OMA, EggNOG
Macaque713886CMTM5CKLF like MARVEL transmembrane domain containing 59544Inparanoid, OMA
Mouse67272Cmtm5CKLF-like MARVEL transmembrane domain containing 510090MGI:2447164Inparanoid, OMA, EggNOG
Dog608193CMTM5CKLF like MARVEL transmembrane domain containing 59615VGNC:39382Inparanoid, OMA, EggNOG
HorseCMTM5CKLF like MARVEL transmembrane domain containing 5 [Source:HGNC Symbol;Acc:HGNC:19176]9796OMA, EggNOG
Cow510145CMTM5CKLF like MARVEL transmembrane domain containing 59913VGNC:27485Inparanoid, OMA, EggNOG
Pig100514659CMTM5CKLF like MARVEL transmembrane domain containing 59823Inparanoid, OMA, EggNOG
Opossum100030600CMTM5CKLF like MARVEL transmembrane domain containing 513616Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.