🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CHST3

DescripciónCarbohydrate sulfotransferase 3

Gene and Protein Information

Gene ID9469
Uniprot Accession IDs Q7LGC8 O75099 Q52M30
Ensembl ID ENSP00000362207
Symbol HSD C6ST C6ST1
FamilyBelongs to the sulfotransferase 1 family. Gal/GlcNAc/GalNAc subfamily.
Sequence
MEKGLTLPQDCRDFVHSLKMRSKYALFLVFVVIVFVFIEKENKIISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRLRNLSLQLGVEPAMEAAGEEEEEQRKEEEPPRPAVAGPRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFEPLWHIERTVSFEPGGANAAGSALVYRDVLKQLFLCDLYVLEHFITPLPEDHLTQFMFRRGSSRSLCEDPVCTPFVKKVFEKYHCKNRRCGPLNVTLAAEACRRKEHMALKAVRIRQLEFLQPLAEDPRLDLRVIQLVRDPRAVLASRMVAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARGPLQKAREMYRFAGIPLTPQVEDWIQKNTQAAHDGSGIYSTQKNSSEQFEKWRFSMPFKLAQVVQAACGPAMRLFGYKLARDAAALTNRSVSLLEERGTFWVT
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp466290CHST3carbohydrate sulfotransferase 39598VGNC:12282OMA, EggNOG
Mouse53374Chst3carbohydrate (chondroitin 6/keratan) sulfotransferase 310090MGI:1858224Inparanoid, OMA, EggNOG
Rat84468Chst3carbohydrate sulfotransferase 310116RGD:620355Inparanoid, OMA, EggNOG
Dog100855759CHST3carbohydrate sulfotransferase 39615VGNC:39255Inparanoid, OMA, EggNOG
Horse100063554CHST3carbohydrate sulfotransferase 39796VGNC:16537Inparanoid, OMA, EggNOG
Cow506758CHST3carbohydrate sulfotransferase 39913VGNC:27345Inparanoid, OMA, EggNOG
Pig100151968CHST3carbohydrate sulfotransferase 39823Inparanoid, OMA, EggNOG
Opossum100010061CHST3carbohydrate sulfotransferase 313616Inparanoid, OMA, EggNOG
Chicken396018CHST3carbohydrate sulfotransferase 39031CGNC:49608Inparanoid, OMA
Anole lizard100568098chst3carbohydrate sulfotransferase 328377Inparanoid, OMA, EggNOG
Xenopus100492673chst3carbohydrate (chondroitin 6) sulfotransferase 38364XB-GENE-993289OMA, EggNOG
Zebrafish559721chst3acarbohydrate (chondroitin 6) sulfotransferase 3a7955ZDB-GENE-090312-180Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.