224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Phorbol-12-myristate-13-acetate-induced protein 1 |
|---|
Gene and Protein Information
| Gene ID | 5366 |
|---|---|
| Uniprot Accession IDs | Q13794 B2R4T7 Q8N589 PMA-induced protein 1 |
| Ensembl ID | ENSP00000326119 |
| Symbol | NOXA APR NOXA |
| Family | Belongs to the PMAIP1 family. |
| Sequence | MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Dog | 100502558 | PMAIP1 | phorbol-12-myristate-13-acetate-induced protein 1 | 9615 | VGNC:53752 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.