🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA Structure
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

ARF6

DescripciónADP-ribosylation factor 6

Gene and Protein Information

Gene ID382
Uniprot Accession IDs P62330 P26438 Q6FGZ2
Ensembl ID ENSP00000298316
FamilyBelongs to the small GTPase superfamily. Arf family.
Sequence
MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Mouse11845Arf6ADP-ribosylation factor 610090MGI:99435Inparanoid, OMA, EggNOG
Rat79121Arf6ADP-ribosylation factor 610116RGD:621279Inparanoid, OMA
Dog490679ARF6ADP ribosylation factor 69615VGNC:38031Inparanoid, OMA, EggNOG
Horse100065920ARF6ADP ribosylation factor 69796VGNC:15446Inparanoid, OMA, EggNOG
Cow100294979ARF6ADP ribosylation factor 69913VGNC:26061Inparanoid, OMA, EggNOG
Pig780425ARF6ADP ribosylation factor 69823Inparanoid, OMA, EggNOG
Opossum100024405ARF6ADP ribosylation factor 613616Inparanoid, EggNOG
Platypus100077992ARF6ADP ribosylation factor 69258Inparanoid, OMA, EggNOG
Chicken428927ARF6ADP ribosylation factor 69031CGNC:53514Inparanoid, OMA
Anole lizard100562975arf6ADP ribosylation factor 628377Inparanoid, OMA, EggNOG
Xenopus448503arf6.2ADP ribosylation factor 68364XB-GENE-967358Inparanoid, OMA, EggNOG
Zebrafish100003206arf6bADP-ribosylation factor 6b7955ZDB-GENE-030131-9056Inparanoid, OMA
C. elegans191608arf-6ADP-Ribosylation Factor related6239Inparanoid, OMA, EggNOG
Fruitfly36699Arf51FADP ribosylation factor at 51F7227FBgn0013750Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.