🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

ARPC5L

DescripciónActin-related protein 2/3 complex subunit 5-like protein

Gene and Protein Information

Gene ID81873
Uniprot Accession IDs Q9BPX5 Q7Z523
Ensembl ID ENSP00000345361
Symbol ARC16-2
FamilyBelongs to the ARPC5 family.
Sequence
MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp739553ARPC5Lactin related protein 2/3 complex subunit 5 like9598VGNC:13853OMA, EggNOG
Mouse74192Arpc5lactin related protein 2/3 complex, subunit 5-like10090MGI:1921442Inparanoid, OMA, EggNOG
Rat296710Arpc5lactin related protein 2/3 complex, subunit 5-like10116RGD:1308867Inparanoid, OMA, EggNOG
Dog612856ARPC5Lactin related protein 2/3 complex subunit 5 like9615VGNC:38132Inparanoid, OMA, EggNOG
Horse100067289ARPC5Lactin related protein 2/3 complex subunit 5 like9796VGNC:15540Inparanoid, OMA, EggNOG
Cow613421ARPC5Lactin related protein 2/3 complex subunit 5 like9913VGNC:26166Inparanoid, OMA, EggNOG
Pig100154462ARPC5Lactin related protein 2/3 complex subunit 5 like9823OMA, EggNOG
Opossum100015743ARPC5Lactin related protein 2/3 complex subunit 5 like13616Inparanoid, EggNOG
Platypus100078118ARPC5Lactin related protein 2/3 complex subunit 5 like9258OMA, EggNOG
Chicken101752218ARPC5Lactin related protein 2/3 complex subunit 5 like9031CGNC:71626OMA, EggNOG
Anole lizard100556158LOC100556158actin-related protein 2/3 complex subunit 5-like protein28377OMA, EggNOG
Xenopus734053arpc5lactin related protein 2/3 complex subunit 5-like8364XB-GENE-490524Inparanoid, OMA, EggNOG
Zebrafish393550arpc5laactin related protein 2/3 complex, subunit 5-like, a7955ZDB-GENE-040426-1453OMA, EggNOG
C. elegans171882arx-7Actin-related protein 2/3 complex subunit 56239OMA, EggNOG
C. elegans183522C46H11.3Probable actin-related protein 2/3 complex subunit 56239Inparanoid, OMA
S.cerevisiae854748ARC15Arc15p4932S000001324OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    cytoskeletal protein    /    actin family cytoskeletal protein    /    Actin-related protein 2/3 complex subunit 5-like protein
DTO Classes
protein    /    Cellular structure    /    Actin family cytoskeletal protein    /    Actin-related protein 2/3 complex subunit 5-like protein

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.