🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

EEF1G

DescripciónElongation factor 1-gamma

Gene and Protein Information

Gene ID1937
Uniprot Accession IDs P26641 B4DTG2 Q6PJ62 Q6PK31 Q96CU2 Q9P196 EF-1-gamma
Ensembl ID ENSP00000331901
Symbol EF1G EF1G GIG35
Sequence
MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp451253EEF1Geukaryotic translation elongation factor 1 gamma9598VGNC:11344OMA, EggNOG
Macaque722274EEF1Geukaryotic translation elongation factor 1 gamma9544OMA, EggNOG
Mouse67160Eef1geukaryotic translation elongation factor 1 gamma10090MGI:1914410Inparanoid, OMA, EggNOG
Rat293725Eef1geukaryotic translation elongation factor 1 gamma10116RGD:1302939Inparanoid, OMA, EggNOG
Dog611396EEF1Geukaryotic translation elongation factor 1 gamma9615Inparanoid, OMA, EggNOG
Horse100009686EEF1Geukaryotic translation elongation factor 1 gamma9796VGNC:17431Inparanoid, OMA, EggNOG
Cow326581EEF1Geukaryotic translation elongation factor 1 gamma9913VGNC:28334Inparanoid, OMA, EggNOG
Pig397022EEF1Geukaryotic translation elongation factor 1 gamma9823Inparanoid, OMA, EggNOG
Opossum100011874EEF1Geukaryotic translation elongation factor 1 gamma13616OMA, EggNOG
Xenopus394875eef1geukaryotic translation elongation factor 1 gamma8364XB-GENE-975013Inparanoid, OMA, EggNOG
Zebrafish195822eef1geukaryotic translation elongation factor 1 gamma7955ZDB-GENE-020423-3Inparanoid, OMA
Fruitfly44791Ef1gammaCG11901 gene product from transcript CG11901-RC7227FBgn0029176Inparanoid, EggNOG
S.cerevisiae856059CAM1translation elongation factor EF1B gamma4932S000005969OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.