🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

GDNF

DescripciónGlial cell line-derived neurotrophic factor

Gene and Protein Information

Gene ID2668
Uniprot Accession IDs P39905 B7WPK7 O95448 O95449 O95986 Q6FH33 Q96L44 Q9UD32 Q9UD33 Q9UMV2 Q9UP67 Q9UP97 hGDNF
Ensembl ID ENSP00000409007
Symbol ATF ATF1 ATF2 HSCR3 HFB1-GDNF
FamilyBelongs to the TGF-beta family. GDNF subfamily.
Sequence
MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp471566GDNFglial cell derived neurotrophic factor9598VGNC:14838OMA, EggNOG
Macaque706345GDNFglial cell derived neurotrophic factor9544Inparanoid, OMA
Mouse14573Gdnfglial cell line derived neurotrophic factor10090MGI:107430Inparanoid, OMA, EggNOG
Rat25453Gdnfglial cell derived neurotrophic factor10116RGD:2677Inparanoid, OMA, EggNOG
Dog489224GDNFglial cell derived neurotrophic factor9615VGNC:41166Inparanoid, OMA, EggNOG
Horse100067053GDNFglial cell derived neurotrophic factor9796VGNC:18295Inparanoid, OMA, EggNOG
Cow386587GDNFglial cell derived neurotrophic factor9913VGNC:29309Inparanoid, OMA, EggNOG
Opossum100014283GDNFglial cell derived neurotrophic factor13616Inparanoid, OMA, EggNOG
PlatypusGDNFglial cell derived neurotrophic factor [Source:HGNC Symbol;Acc:HGNC:4232]9258OMA, EggNOG
Chicken395569GDNFglial cell derived neurotrophic factor9031CGNC:2717Inparanoid, OMA, EggNOG
Anole lizard100563031gdnfglial cell derived neurotrophic factor28377Inparanoid, OMA, EggNOG
Xenopus100498061gdnfglial cell derived neurotrophic factor8364XB-GENE-483795Inparanoid, OMA, EggNOG
Zebrafish79379gdnfaglial cell derived neurotrophic factor a7955ZDB-GENE-010226-1OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    growth factor    /    neurotrophic factor    /    Glial cell line-derived neurotrophic factor
DTO Classes
protein    /    Signaling    /    Growth factor    /    Neurotrophic factor    /    Glial cell line-derived neurotrophic factor

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.