🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

KCNJ9

DescripciónG protein-activated inward rectifier potassium channel 3

Gene and Protein Information

Gene ID3765
Uniprot Accession IDs Q92806 Q5JW75 GIRK-3
Ensembl ID ENSP00000357067
Symbol GIRK3 GIRK3 KIR3.3
FamilyBelongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ9 subfamily.
Sequence
MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLSLLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETTIGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEKVEEEGAGEGAGGEAGADKEQNGCLPPPESESKV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp469548KCNJ9potassium voltage-gated channel subfamily J member 99598VGNC:10678OMA, EggNOG
Mouse16524Kcnj9potassium inwardly-rectifying channel, subfamily J, member 910090MGI:108007Inparanoid, OMA, EggNOG
Rat116560Kcnj9potassium voltage-gated channel subfamily J member 910116RGD:621440Inparanoid, OMA, EggNOG
Dog100855823KCNJ9potassium voltage-gated channel subfamily J member 99615VGNC:42269Inparanoid, OMA, EggNOG
Cow614969KCNJ9potassium voltage-gated channel subfamily J member 99913VGNC:30464Inparanoid, OMA, EggNOG
Pig100152828KCNJ9potassium voltage-gated channel subfamily J member 99823Inparanoid, OMA
Opossum100029817KCNJ9potassium voltage-gated channel subfamily J member 913616Inparanoid, OMA, EggNOG
Platypus100086093KCNJ9potassium voltage-gated channel subfamily J member 99258Inparanoid, OMA, EggNOG
Anole lizard100567687kcnj9potassium voltage-gated channel subfamily J member 928377Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Ion channel    /    Inward rectifier-type potassium channel family    /    KCNJ9 subfamily    /    G protein-activated inward rectifier potassium channel 3

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.