HIST1H2AA

DescripciónHistone H2A type 1-A

Gene and Protein Information

Gene ID221613
Uniprot Accession IDs Q96QV6
Ensembl ID ENSP00000297012
Symbol H2AFR H2AA TH2A H2AFR bA317E16.2
FamilyBelongs to the histone H2A family.
Sequence
MSGRGKQGGKARAKSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHHHKAQSK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp462486HIST1H2AAhistone cluster 1 H2A family member a9598VGNC:14358OMA, EggNOG
Dog488251HIST1H2AAhistone cluster 1, H2aa9615Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    histone    /    Histone H2A type 1-A
DTO Classes
protein    /    Nucleic acid binding    /    DNA binding protein    /    Histone    /    Histone H2A type 1-A

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.