224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Histone H1.0 |
|---|
Gene and Protein Information
| Gene ID | 3005 |
|---|---|
| Uniprot Accession IDs | P07305 B2R6I0 B4DRD6 Q6FG88 Q8N6R3 |
| Ensembl ID | ENSP00000344504 |
| Symbol | H1FV H10 H1FV |
| Family | Belongs to the histone H1/H5 family. |
| Sequence | MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 743278 | H1F0 | H1 histone family member 0 | 9598 | VGNC:14352 | OMA, EggNOG |
| Mouse | 14958 | H1f0 | H1 histone family, member 0 | 10090 | MGI:95893 | Inparanoid, OMA, EggNOG |
| Cow | 617975 | H1F0 | H1 histone family, member 0 | 9913 | Inparanoid, OMA, EggNOG | |
| Xenopus | 407939 | h1f0 | H1 histone family member 0 | 8364 | XB-GENE-480028 | Inparanoid, OMA, EggNOG |
| Zebrafish | 321618 | h1f0 | H1 histone family, member 0 | 7955 | ZDB-GENE-030131-337 | Inparanoid, OMA, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.