H2AFX

DescripciónHistone H2AX

Gene and Protein Information

Gene ID3014
Uniprot Accession IDs P16104 Q4ZGJ7 Q6IAS5 H2a/x
Ensembl ID ENSP00000434024
Symbol H2AX H2AX H2A.X H2A/X
FamilyBelongs to the histone H2A family.
Sequence
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp104001345H2AFXH2A histone family member X9598VGNC:12576Inparanoid, OMA, EggNOG
Mouse15270H2afxH2A histone family, member X10090MGI:102688Inparanoid, OMA, EggNOG
Rat500987H2afxH2A histone family, member X10116RGD:1566119Inparanoid, OMA, EggNOG
Dog489372LOC489372histone H2AX9615OMA, EggNOG
Cow531733H2AFXH2A histone family, member X9913Inparanoid, OMA, EggNOG
Platypus100086273LOC100086273histone H2A9258OMA, EggNOG
Xenopus548722h2afxH2A histone family member X8364XB-GENE-855944Inparanoid, OMA, EggNOG
Zebrafish394048h2afxH2A histone family, member X7955ZDB-GENE-040426-987Inparanoid, OMA, EggNOG
C. elegans179339his-35Histone H2A6239Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    histone    /    Histone H2AX
DTO Classes
protein    /    Nucleic acid binding    /    DNA binding protein    /    Histone    /    Histone H2AX

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.