🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

IFI35

DescripciónInterferon-induced 35 kDa protein

Gene and Protein Information

Gene ID3430
Uniprot Accession IDs P80217 C9JGX1 Q92984 Q99537 Q9BV98 IFP 35
Ensembl ID ENSP00000395590
Symbol IFP35 IFP35
FamilyBelongs to the NMI family.
Sequence
MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQMSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp741105IFI35interferon induced protein 359598VGNC:9330OMA, EggNOG
Macaque712409IFI35interferon induced protein 359544Inparanoid, OMA, EggNOG
Mouse70110Ifi35interferon-induced protein 3510090MGI:1917360Inparanoid, OMA, EggNOG
Rat287719Ifi35interferon-induced protein 3510116RGD:1304553Inparanoid, OMA, EggNOG
Dog490954IFI35interferon induced protein 359615VGNC:41872Inparanoid, OMA, EggNOG
Horse100052050IFI35interferon induced protein 359796VGNC:18943Inparanoid, OMA, EggNOG
Cow510697IFI35interferon induced protein 359913VGNC:30044Inparanoid, OMA, EggNOG
Pig100624758IFI35interferon induced protein 359823OMA, EggNOG
Opossum100011080IFI35interferon induced protein 3513616Inparanoid, OMA, EggNOG
Chicken420011IFI35interferon-induced protein 359031CGNC:2041Inparanoid, OMA, EggNOG
Anole lizard100553322ifi35interferon induced protein 3528377Inparanoid, OMA, EggNOG
Xenopusifi35interferon induced protein 35 [Source:Xenbase;Acc:XB-GENE-1010748]8364OMA, EggNOG
Zebrafish559610ifi35interferon-induced protein 357955ZDB-GENE-100311-2OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transcription factor    /    transcription cofactor    /    Interferon-induced 35 kDa protein
DTO Classes
protein    /    Transcription factor    /    Transcription cofactor    /    Interferon-induced 35 kDa protein

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.