🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

GPR143

DescripciónG-protein coupled receptor 143

Gene and Protein Information

Gene ID4935
Uniprot Accession IDs P51810 Q6NTI7
Ensembl ID ENSP00000417161
Symbol OA1 OA1 NYS6
FamilyBelongs to the G-protein coupled receptor OA family.
Sequence
MASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSPATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSAMWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPSVSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGAVIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNPAQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVGGQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque709148GPR143G protein-coupled receptor 1439544Inparanoid, OMA, EggNOG
Mouse18241Gpr143G protein-coupled receptor 14310090MGI:107193Inparanoid, OMA, EggNOG
Rat302619Gpr143G protein-coupled receptor 14310116RGD:1565799Inparanoid, OMA, EggNOG
Horse100147328GPR143G protein-coupled receptor 1439796VGNC:18515Inparanoid, OMA, EggNOG
Cow613505GPR143G protein-coupled receptor 1439913Inparanoid, OMA, EggNOG
Opossum100032098GPR143G protein-coupled receptor 14313616Inparanoid, OMA, EggNOG
Chicken418652GPR143G protein-coupled receptor 1439031CGNC:12450Inparanoid, OMA, EggNOG
Anole lizard100555530gpr143G protein-coupled receptor 14328377Inparanoid, OMA, EggNOG
Xenopus496427gpr143G protein-coupled receptor 1438364XB-GENE-5848649Inparanoid, OMA, EggNOG
Zebrafish393795gpr143G protein-coupled receptor 1437955ZDB-GENE-040426-1476Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Other 7TM proteins    /    G-protein coupled receptor 143

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.