224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Golgi membrane protein 1 |
|---|
Gene and Protein Information
| Gene ID | 51280 |
|---|---|
| Uniprot Accession IDs | Q8NBJ4 Q6IAF4 Q9NRB9 |
| Ensembl ID | ENSP00000373364 |
| Symbol | C9orf155 GOLPH2 GP73 HEL46 GOLPH2 C9orf155 PSEC0257 bA379P1.3 |
| Family | Belongs to the GOLM1/CASC4 family. |
| Sequence | MMGLGNGRRSMKSPPLVLAALVACIIVLGFNYWIASSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 464562 | GOLM1 | golgi membrane protein 1 | 9598 | VGNC:13888 | OMA, EggNOG |
| Macaque | 715029 | GOLM1 | golgi membrane protein 1 | 9544 | OMA, EggNOG | |
| Mouse | 105348 | Golm1 | golgi membrane protein 1 | 10090 | MGI:1917329 | Inparanoid, OMA, EggNOG |
| Rat | 680692 | Golm1 | golgi membrane protein 1 | 10116 | RGD:1589384 | Inparanoid, OMA, EggNOG |
| Dog | 476303 | GOLM1 | golgi membrane protein 1 | 9615 | VGNC:41345 | Inparanoid, OMA, EggNOG |
| Horse | GOLM1 | golgi membrane protein 1 [Source:HGNC Symbol;Acc:HGNC:15451] | 9796 | OMA, EggNOG | ||
| Cow | 517052 | GOLM1 | golgi membrane protein 1 | 9913 | VGNC:29491 | Inparanoid, OMA, EggNOG |
| Pig | 100517183 | GOLM1 | golgi membrane protein 1 | 9823 | OMA, EggNOG | |
| Opossum | 100029161 | GOLM1 | golgi membrane protein 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 427462 | GOLM1 | golgi membrane protein 1 | 9031 | CGNC:9562 | Inparanoid, EggNOG |
| Anole lizard | 100557871 | golm1 | golgi membrane protein 1 | 28377 | Inparanoid, OMA | |
| Xenopus | 779448 | golm1 | golgi membrane protein 1 | 8364 | XB-GENE-1002584 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.