🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

GOPC

DescripciónGolgi-associated PDZ and coiled-coil motif-containing protein

Gene and Protein Information

Gene ID57120
Uniprot Accession IDs Q9HD26 A6NM30 Q59FS4 Q969U8
Ensembl ID ENSP00000357484
Symbol CAL FIG CAL FIG PIST GOPC1 dJ94G16.2
Sequence
MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVHDQLLQLHSIQLQLHAKTGQSADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp462964GOPCgolgi associated PDZ and coiled-coil motif containing9598VGNC:11085OMA, EggNOG
Mouse94221Gopcgolgi associated PDZ and coiled-coil motif containing10090MGI:2149946Inparanoid, OMA, EggNOG
Rat309774Gopcgolgi associated PDZ and coiled-coil motif containing10116RGD:1309512Inparanoid, OMA
Dog484100GOPCgolgi associated PDZ and coiled-coil motif containing9615VGNC:49713Inparanoid, OMA, EggNOG
Cow541186GOPCgolgi associated PDZ and coiled-coil motif containing9913VGNC:53793Inparanoid, OMA, EggNOG
Pig100520524GOPCgolgi associated PDZ and coiled-coil motif containing9823Inparanoid, OMA, EggNOG
Opossum100030077GOPCgolgi associated PDZ and coiled-coil motif containing13616Inparanoid, OMA, EggNOG
Chicken770364GOPCgolgi associated PDZ and coiled-coil motif containing9031CGNC:11060Inparanoid, OMA, EggNOG
Anole lizard100553890gopcgolgi associated PDZ and coiled-coil motif containing28377Inparanoid, OMA, EggNOG
Xenopus100145196gopcgolgi-associated PDZ and coiled-coil motif containing8364XB-GENE-5857191Inparanoid, OMA, EggNOG
Zebrafish326887gopcgolgi-associated PDZ and coiled-coil motif containing7955ZDB-GENE-030131-5086Inparanoid, OMA, EggNOG
C. elegans3565651gopc-1GOlgi-associated PDZ and Coiled-coil motif protein6239Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.