224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Interferon regulatory factor 1 |
|---|
Gene and Protein Information
| Gene ID | 3659 |
|---|---|
| Uniprot Accession IDs | P10914 Q96GG7 IRF-1 |
| Ensembl ID | ENSP00000245414 |
| Symbol | MAR IRF-1 |
| Family | Belongs to the IRF family. |
| Sequence | MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 107974852 | IRF1 | interferon regulatory factor 1 | 9598 | VGNC:4049 | OMA, EggNOG |
| Macaque | 707788 | IRF1 | interferon regulatory factor 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 16362 | Irf1 | interferon regulatory factor 1 | 10090 | MGI:96590 | Inparanoid, OMA, EggNOG |
| Rat | 24508 | Irf1 | interferon regulatory factor 1 | 10116 | RGD:2920 | Inparanoid, OMA, EggNOG |
| Dog | 100855872 | IRF1 | interferon regulatory factor 1 | 9615 | VGNC:42091 | Inparanoid, OMA, EggNOG |
| Horse | 100063253 | IRF1 | interferon regulatory factor 1 | 9796 | VGNC:19130 | Inparanoid, OMA, EggNOG |
| Cow | 789216 | IRF1 | interferon regulatory factor 1 | 9913 | VGNC:30270 | Inparanoid, OMA, EggNOG |
| Pig | 396611 | IRF1 | interferon regulatory factor 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100018712 | IRF1 | interferon regulatory factor 1 | 13616 | Inparanoid, EggNOG | |
| Platypus | IRF1 | interferon regulatory factor 1 [Source:HGNC Symbol;Acc:HGNC:6116] | 9258 | OMA, EggNOG | ||
| Chicken | 396384 | IRF1 | interferon regulatory factor 1 | 9031 | CGNC:5120 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100566668 | irf1 | interferon regulatory factor 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448320 | irf1 | interferon regulatory factor 1 | 8364 | XB-GENE-942994 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.