🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

IRF2

DescripciónInterferon regulatory factor 2

Gene and Protein Information

Gene ID3660
Uniprot Accession IDs P14316 D6RCK5 H0Y8S3 Q6IAS7 Q96B99 IRF-2
Ensembl ID ENSP00000377218
Symbol IRF-2
FamilyBelongs to the IRF family.
Sequence
MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque694347IRF2interferon regulatory factor 29544Inparanoid, OMA, EggNOG
Mouse16363Irf2interferon regulatory factor 210090MGI:96591Inparanoid, OMA, EggNOG
Rat290749Irf2interferon regulatory factor 210116RGD:1304922Inparanoid, OMA, EggNOG
Dog475633IRF2interferon regulatory factor 29615VGNC:42092Inparanoid, OMA, EggNOG
Horse100050990IRF2interferon regulatory factor 29796VGNC:19131Inparanoid, OMA, EggNOG
Cow337916IRF2interferon regulatory factor 29913VGNC:30271Inparanoid, OMA, EggNOG
Pig100621620IRF2interferon regulatory factor 29823Inparanoid, OMA, EggNOG
Opossum100012282IRF2interferon regulatory factor 213616Inparanoid, OMA, EggNOG
Chicken396115IRF2interferon regulatory factor 29031CGNC:8084Inparanoid, OMA
Anole lizard100559594irf2interferon regulatory factor 228377Inparanoid, OMA, EggNOG
Xenopus493376irf2interferon regulatory factor 28364XB-GENE-942910Inparanoid, OMA, EggNOG
Zebrafish494071irf2interferon regulatory factor 27955ZDB-GENE-041212-38OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.