224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Potassium channel subfamily K member 9 |
|---|
Gene and Protein Information
| Gene ID | 51305 |
|---|---|
| Uniprot Accession IDs | Q9NPC2 Q2M290 Q540F2 |
| Ensembl ID | ENSP00000430676 |
| Symbol | TASK3 KT3.2 TASK3 K2p9.1 TASK-3 |
| Family | Belongs to the two pore domain potassium channel (TC 1.A.1.8) family. |
| Sequence | MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 100425983 | KCNK9 | potassium two pore domain channel subfamily K member 9 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 223604 | Kcnk9 | potassium channel, subfamily K, member 9 | 10090 | MGI:3521816 | Inparanoid, OMA, EggNOG |
| Rat | 84429 | Kcnk9 | potassium two pore domain channel subfamily K member 9 | 10116 | RGD:621451 | Inparanoid, OMA, EggNOG |
| Dog | 482057 | KCNK9 | potassium two pore domain channel subfamily K member 9 | 9615 | VGNC:42280 | Inparanoid, OMA |
| Horse | 100058202 | KCNK9 | potassium two pore domain channel subfamily K member 9 | 9796 | VGNC:19302 | Inparanoid, OMA |
| Cow | 539586 | KCNK9 | potassium two pore domain channel subfamily K member 9 | 9913 | VGNC:30478 | Inparanoid, OMA |
| Opossum | 100027125 | KCNK9 | potassium two pore domain channel subfamily K member 9 | 13616 | Inparanoid, OMA | |
| Anole lizard | 100555658 | kcnk9 | potassium two pore domain channel subfamily K member 9 | 28377 | Inparanoid, OMA | |
| Zebrafish | 799704 | kcnk9 | potassium channel, subfamily K, member 9 | 7955 | ZDB-GENE-070705-260 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / Ion channel / Two pore domain potassium channel family / Potassium channel subfamily K member 9
protein / Ion channel / Two pore domain potassium channel family / Potassium channel subfamily K member 9
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.