224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Potassium channel subfamily K member 13 |
|---|
Gene and Protein Information
| Gene ID | 56659 |
|---|---|
| Uniprot Accession IDs | Q9HB14 B5TJL8 Q96E79 |
| Ensembl ID | ENSP00000282146 |
| Symbol | THIK1 THIK-1 K2p13.1 |
| Family | Belongs to the two pore domain potassium channel (TC 1.A.1.8) family. |
| Sequence | MAGRGFSWGPGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWEERLANFSRGHNLSRDELRGFLRHYEEATRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPATVGGKIFLIFYGLVGCSSTILFFNLFLERLITIIAYIMKSCHQRQLRRRGALPQESLKDAGQCEVDSLAGWKPSVYYVMLILCTASILISCCASAMYTPIEGWSYFDSLYFCFVAFSTIGFGDLVSSQNAHYESQGLYRFANFVFILMGVCCIYSLFNVISILIKQSLNWILRKMDSGCCPQCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTDGRRLSGEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIMNNRLAETSGDR Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 737631 | KCNK13 | potassium two pore domain channel subfamily K member 13 | 9598 | VGNC:7445 | OMA, EggNOG |
| Macaque | KCNK13 | potassium two pore domain channel subfamily K member 13 [Source:HGNC Symbol;Acc:HGNC:6275] | 9544 | Inparanoid, OMA, EggNOG | ||
| Mouse | 217826 | Kcnk13 | potassium channel, subfamily K, member 13 | 10090 | MGI:2384976 | Inparanoid, OMA, EggNOG |
| Rat | 64120 | Kcnk13 | potassium two pore domain channel subfamily K member 13 | 10116 | RGD:68941 | Inparanoid, OMA, EggNOG |
| Dog | 490829 | KCNK13 | potassium two pore domain channel subfamily K member 13 | 9615 | VGNC:53499 | Inparanoid, OMA |
| Horse | KCNK13 | potassium two pore domain channel subfamily K member 13 [Source:HGNC Symbol;Acc:HGNC:6275] | 9796 | OMA, EggNOG | ||
| Pig | 100623906 | KCNK13 | potassium two pore domain channel subfamily K member 13 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100018915 | KCNK13 | potassium two pore domain channel subfamily K member 13 | 13616 | Inparanoid, EggNOG | |
| Chicken | 772210 | KCNK13 | potassium two pore domain channel subfamily K member 13 | 9031 | CGNC:8108 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100562988 | kcnk13 | potassium two pore domain channel subfamily K member 13 | 28377 | Inparanoid, OMA | |
| Zebrafish | 571467 | kcnk13a | potassium channel, subfamily K, member 13a | 7955 | ZDB-GENE-080219-46 | OMA, EggNOG |
| Zebrafish | 556073 | kcnk13b | potassium channel, subfamily K, member 13b | 7955 | ZDB-GENE-040724-105 | Inparanoid, OMA |
| C. elegans | 179699 | twk-14 | TWiK family of potassium channels | 6239 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / Ion channel / Two pore domain potassium channel family / Potassium channel subfamily k member 13
protein / Ion channel / Two pore domain potassium channel family / Potassium channel subfamily k member 13
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.