224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Integrator complex subunit 9 |
|---|
Gene and Protein Information
| Gene ID | 55756 |
|---|---|
| Uniprot Accession IDs | Q9NV88 B7Z560 B7Z6M5 O00224 Q8TB16 Int9 |
| Ensembl ID | ENSP00000429065 |
| Symbol | RC74 INT9 RC74 CPSF2L |
| Family | Belongs to the metallo-beta-lactamase superfamily. RNA-metabolizing metallo-beta-lactamase-like family. INTS9 subfamily. |
| Sequence | MKLYCLSGHPTLPCNVLKFKSTTIMLDCGLDMTSTLNFLPLPLVQSPRLSNLPGWSLKDGNAFLDKELKECSGHVFVDSVPEFCLPETELIDLSTVDVILISNYHCMMALPYITEHTGFTGTVYATEPTVQIGRLLMEELVNFIERVPKAQSASLWKNKDIQRLLPSPLKDAVEVSTWRRCYTMQEVNSALSKIQLVGYSQKIELFGAVQVTPLSSGYALGSSNWIIQSHYEKVSYVSGSSLLTTHPQPMDQASLKNSDVLVLTGLTQIPTANPDGMVGEFCSNLALTVRNGGNVLVPCYPSGVIYDLLECLYQYIDSAGLSSVPLYFISPVANSSLEFSQIFAEWLCHNKQSKVYLPEPPFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTVIFTEPDFSYLEALAPYQPLAMKCIYCPIDTRLNFIQVSKLLKEVQPLHVVCPEQYTQPPPAQSHRMDLMIDCQPPAMSYRRAEVLALPFKRRYEKIEIMPELADSLVPMEIKPGISLATVSAVLHTKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 745212 | INTS9 | integrator complex subunit 9 | 9598 | VGNC:859 | OMA, EggNOG |
| Macaque | 718598 | INTS9 | integrator complex subunit 9 | 9544 | OMA, EggNOG | |
| Mouse | 210925 | Ints9 | integrator complex subunit 9 | 10090 | MGI:1098533 | Inparanoid, OMA, EggNOG |
| Rat | 290322 | Ints9 | integrator complex subunit 9 | 10116 | RGD:1311539 | Inparanoid, OMA, EggNOG |
| Dog | 486090 | INTS9 | integrator complex subunit 9 | 9615 | VGNC:42058 | Inparanoid, OMA, EggNOG |
| Horse | 100061398 | INTS9 | integrator complex subunit 9 | 9796 | VGNC:19097 | Inparanoid, OMA, EggNOG |
| Cow | 533964 | INTS9 | integrator complex subunit 9 | 9913 | VGNC:30234 | Inparanoid, OMA, EggNOG |
| Pig | 100155552 | INTS9 | integrator complex subunit 9 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100033173 | INTS9 | integrator complex subunit 9 | 13616 | Inparanoid, EggNOG | |
| Chicken | 422023 | INTS9 | integrator complex subunit 9 | 9031 | CGNC:12464 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100557312 | ints9 | integrator complex subunit 9 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 768124 | ints9 | integrator complex subunit 9 | 7955 | ZDB-GENE-061013-129 | Inparanoid, OMA, EggNOG |
| C. elegans | 179142 | F19F10.12 | hypothetical protein | 6239 | OMA, EggNOG | |
| Fruitfly | 39763 | IntS9 | Integrator 9 | 7227 | FBgn0036570 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.