🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA Structure
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

GSTO1

DescripciónGlutathione S-transferase omega-1

Gene and Protein Information

Gene ID9446
Uniprot Accession IDs P78417 D3DRA3 F5H7H0 Q5TA03 Q7Z3T2 GSTO-1
Ensembl ID ENSP00000358727
Symbol GSTTLP28 P28 SPG-R GSTO 1-1 GSTTLp28 HEL-S-21
FamilyBelongs to the GST superfamily. Omega family.
Sequence
MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp450719GSTO1glutathione S-transferase omega 19598VGNC:12340Inparanoid, OMA, EggNOG
Macaque716078GSTO1glutathione S-transferase omega 19544Inparanoid, OMA, EggNOG
Mouse14873Gsto1glutathione S-transferase omega 110090MGI:1342273Inparanoid, OMA, EggNOG
Rat114846Gsto1glutathione S-transferase omega 110116RGD:70952Inparanoid, OMA, EggNOG
Dog477813GSTO1glutathione S-transferase omega 19615VGNC:41536Inparanoid, OMA
Horse100069640GSTO1glutathione S-transferase omega 19796VGNC:18628Inparanoid, OMA
Cow785216GSTO1glutathione S-transferase omega 19913Inparanoid, OMA
Pig397117GSTO1glutathione S-transferase omega 19823Inparanoid, OMA
Chicken423881GSTO1glutathione S-transferase omega 19031CGNC:52072Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.