🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

GSTK1

DescripciónGlutathione S-transferase kappa 1

Gene and Protein Information

Gene ID373156
Uniprot Accession IDs Q9Y2Q3 B4DIH1 B4DSY2 Q6P4H0 Q7Z520 Q9P1S4
Ensembl ID ENSP00000431049
Symbol GST GST13 hGSTK1 GSTK1-1 GST13-13 GST 13-13
FamilyBelongs to the GST superfamily. Kappa family.
Sequence
MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp463802GSTK1glutathione S-transferase kappa 19598VGNC:4382Inparanoid, OMA, EggNOG
Macaque704240GSTK1glutathione S-transferase kappa 19544Inparanoid, OMA, EggNOG
Mouse76263Gstk1glutathione S-transferase kappa 110090MGI:1923513Inparanoid, OMA, EggNOG
Rat297029Gstk1glutathione S-transferase kappa 110116RGD:735188Inparanoid, OMA, EggNOG
Dog475518GSTK1glutathione S-transferase kappa 19615Inparanoid, OMA, EggNOG
Horse100056014GSTK1glutathione S-transferase kappa 19796VGNC:18626Inparanoid, OMA, EggNOG
Cow613498GSTK1glutathione S-transferase kappa 19913VGNC:29685Inparanoid, OMA, EggNOG
Opossum100011709GSTK1glutathione S-transferase kappa 113616OMA, EggNOG
Chicken418302GSTK1glutathione S-transferase kappa 19031CGNC:10904Inparanoid, OMA, EggNOG
Anole lizard100563685gstk1glutathione S-transferase kappa 128377OMA, EggNOG
Zebrafish436833gstk1glutathione S-transferase kappa 17955ZDB-GENE-040718-298OMA, EggNOG
C. elegans191563gstk-1Glutathione S-transferase kappa 16239Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.