🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

FABP2

DescripciónFatty acid-binding protein, intestinal

Gene and Protein Information

Gene ID2169
Uniprot Accession IDs P12104 Q2NKJ1
Ensembl ID ENSP00000274024
Symbol FABPI FABPI I-FABP
FamilyBelongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Sequence
MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp740421FABP2fatty acid binding protein 29598VGNC:7045OMA, EggNOG
Mouse14079Fabp2fatty acid binding protein 2, intestinal10090MGI:95478Inparanoid, OMA, EggNOG
Rat25598Fabp2fatty acid binding protein 210116RGD:2591Inparanoid, OMA, EggNOG
Dog487924FABP2fatty acid binding protein 29615VGNC:40560Inparanoid, OMA, EggNOG
Horse100034050FABP2fatty acid binding protein 29796VGNC:17767OMA, EggNOG
CowFABP2fatty acid binding protein 2 [Source:HGNC Symbol;Acc:HGNC:3556]9913OMA, EggNOG
Opossum100011805FABP2fatty acid binding protein 213616Inparanoid, OMA, EggNOG
Platypus100081780FABP2fatty acid binding protein 29258Inparanoid, OMA, EggNOG
Chicken422678FABP2fatty acid binding protein 29031CGNC:9084Inparanoid, OMA, EggNOG
Anole lizard100566943fabp2fatty acid binding protein 228377Inparanoid, OMA, EggNOG
Xenopus100101805fabp2fatty acid binding protein 28364XB-GENE-485137Inparanoid, OMA, EggNOG
Zebrafish30708fabp2fatty acid binding protein 2, intestinal7955ZDB-GENE-991019-5Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.