🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

FABP1

DescripciónFatty acid-binding protein, liver

Gene and Protein Information

Gene ID2168
Uniprot Accession IDs P07148
Ensembl ID ENSP00000295834
Symbol FABPL FABPL L-FABP
FamilyBelongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Sequence
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp736471FABP1fatty acid binding protein 19598VGNC:7696OMA, EggNOG
Mouse14080Fabp1fatty acid binding protein 1, liver10090MGI:95479Inparanoid, OMA, EggNOG
Rat24360Fabp1fatty acid binding protein 110116RGD:2590Inparanoid, OMA, EggNOG
Dog403619FABP1fatty acid binding protein 19615VGNC:40558Inparanoid, OMA, EggNOG
Horse100052746FABP1fatty acid binding protein 19796VGNC:17765Inparanoid, OMA, EggNOG
Cow327700FABP1fatty acid binding protein 19913VGNC:28695Inparanoid, OMA, EggNOG
Pig445535FABP1fatty acid binding protein 19823Inparanoid, OMA, EggNOG
OpossumFABP1fatty acid binding protein 1 [Source:HGNC Symbol;Acc:HGNC:3555]13616Inparanoid, EggNOG
PlatypusFABP1fatty acid binding protein 1 [Source:HGNC Symbol;Acc:HGNC:3555]9258OMA, EggNOG
Chicken374015FABP1fatty acid binding protein 19031CGNC:11895OMA, EggNOG
Anole lizard100562032fabp1fatty acid binding protein 128377Inparanoid, OMA, EggNOG
Xenopus100144636fabp1fatty acid binding protein 18364XB-GENE-481608Inparanoid, OMA, EggNOG
Zebrafish791610fabp1afatty acid binding protein 1a, liver7955ZDB-GENE-020318-3Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.