🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

GNG2

DescripciónGuanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

Gene and Protein Information

Gene ID54331
Uniprot Accession IDs P59768 Q5JPE2 Q6P9A9
Ensembl ID ENSP00000334448
FamilyBelongs to the G protein gamma family.
Sequence
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque710000GNG2G protein subunit gamma 29544OMA, EggNOG
Mouse14702Gng2guanine nucleotide binding protein (G protein), gamma 210090MGI:102705Inparanoid, OMA, EggNOG
Dog610817GNG2G protein subunit gamma 29615VGNC:53494Inparanoid, OMA, EggNOG
Horse100630067GNG2G protein subunit gamma 29796VGNC:18431Inparanoid, OMA
Cow281203GNG2G protein subunit gamma 29913VGNC:29465Inparanoid, OMA, EggNOG
Pig102165618GNG2G protein subunit gamma 29823OMA, EggNOG
Platypus100084993GNG2G protein subunit gamma 29258Inparanoid, OMA, EggNOG
Chicken423581GNG2G protein subunit gamma 29031CGNC:66456Inparanoid, OMA
Anole lizard100561604gng2G protein subunit gamma 228377Inparanoid, OMA, EggNOG
Xenopus448567gng2guanine nucleotide binding protein (G protein), gamma 28364XB-GENE-961282Inparanoid, OMA, EggNOG
Zebrafish550256gng2guanine nucleotide binding protein (G protein), gamma 27955ZDB-GENE-050417-59Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    heterotrimeric G-protein    /    Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
DTO Classes
protein    /    Enzyme modulator    /    G-protein    /    Heterotrimeric G-protein    /    Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.