GNG2

DescripciónGuanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

Gene and Protein Information

Gene ID54331
Uniprot Accession IDs P59768 Q5JPE2 Q6P9A9
Ensembl ID ENSP00000334448
FamilyBelongs to the G protein gamma family.
Sequence
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque710000GNG2G protein subunit gamma 29544OMA, EggNOG
Mouse14702Gng2guanine nucleotide binding protein (G protein), gamma 210090MGI:102705Inparanoid, OMA, EggNOG
Dog610817GNG2G protein subunit gamma 29615VGNC:53494Inparanoid, OMA, EggNOG
Horse100630067GNG2G protein subunit gamma 29796VGNC:18431Inparanoid, OMA
Cow281203GNG2G protein subunit gamma 29913VGNC:29465Inparanoid, OMA, EggNOG
Pig102165618GNG2G protein subunit gamma 29823OMA, EggNOG
Platypus100084993GNG2G protein subunit gamma 29258Inparanoid, OMA, EggNOG
Chicken423581GNG2G protein subunit gamma 29031CGNC:66456Inparanoid, OMA
Anole lizard100561604gng2G protein subunit gamma 228377Inparanoid, OMA, EggNOG
Xenopus448567gng2guanine nucleotide binding protein (G protein), gamma 28364XB-GENE-961282Inparanoid, OMA, EggNOG
Zebrafish550256gng2guanine nucleotide binding protein (G protein), gamma 27955ZDB-GENE-050417-59Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    heterotrimeric G-protein    /    Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
DTO Classes
protein    /    Enzyme modulator    /    G-protein    /    Heterotrimeric G-protein    /    Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.