🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

IGFBP6

DescripciónInsulin-like growth factor-binding protein 6

Gene and Protein Information

Gene ID3489
Uniprot Accession IDs P24592 Q14492 IBP-6
Ensembl ID ENSP00000301464
Symbol IBP6 IBP6
Sequence
MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp451929IGFBP6insulin like growth factor binding protein 69598VGNC:5428OMA, EggNOG
Mouse16012Igfbp6insulin-like growth factor binding protein 610090MGI:96441Inparanoid, OMA, EggNOG
Rat25641Igfbp6insulin-like growth factor binding protein 610116RGD:2877Inparanoid, OMA, EggNOG
Dog607374IGFBP6insulin like growth factor binding protein 69615VGNC:41907Inparanoid, OMA, EggNOG
Horse100034156IGFBP6insulin like growth factor binding protein 69796VGNC:18975Inparanoid, OMA, EggNOG
Cow404186IGFBP6insulin like growth factor binding protein 69913VGNC:30088Inparanoid, OMA, EggNOG
Pig100101923IGFBP6insulin like growth factor binding protein 69823Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.