The store will not work correctly when cookies are disabled.
Parece que JavaScript está deshabilitado en su navegador. Para obtener la mejor experiencia en nuestro sitio, asegúrese de activar Javascript en su navegador.
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
GLRX Descripción Glutaredoxin-1
Gene and Protein Information Gene ID 2745 Uniprot Accession IDs P35754 B2R4L2 Q3KQS1 Q6ICT1 Ensembl ID ENSP00000369314 Symbol GRX GRX GRX1 Family Belongs to the glutaredoxin family. Sequence MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ
Homologous gene and protein info.
Species Gene ID Gene Symbol Nombre NIF Other Gene ID Sources Chimp 736317 GLRX glutaredoxin 9598 VGNC:4016 Inparanoid, OMA Macaque 698997 GLRX glutaredoxin 9544 Inparanoid, OMA, EggNOG Mouse 93692 Glrx glutaredoxin 10090 MGI:2135625 Inparanoid, OMA, EggNOG Rat 64045 Glrx glutaredoxin 10116 RGD:70951 Inparanoid, OMA, EggNOG Dog 609246 GLRX glutaredoxin 9615 VGNC:41273 Inparanoid, OMA, EggNOG Horse 100064937 GLRX glutaredoxin 9796 VGNC:18390 Inparanoid, OMA, EggNOG Opossum 100009967 GLRX glutaredoxin 13616 Inparanoid, OMA, EggNOG Chicken 396069 GLRX glutaredoxin 9031 CGNC:49637 Inparanoid, OMA, EggNOG Anole lizard 100562408 glrx glutaredoxin 28377 Inparanoid, OMA, EggNOG Xenopus 549351 glrx glutaredoxin 8364 XB-GENE-971624 Inparanoid, OMA, EggNOG Zebrafish 449769 glrx glutaredoxin (thioltransferase) 7955 ZDB-GENE-041010-11 Inparanoid, OMA, EggNOG C. elegans 171685 glrx-10 GLutaRedoXin 6239 Inparanoid, OMA, EggNOG
Associated Recombinant Proteins Nombre Specification and purity Expression system Protein label Disponibilidad Mostrar detalles
Associated Antibodies
Nombre Specifications Species reactivity Aplicación Disponibilidad Mostrar detalles
Associated Approved Drugs Associated Active Ligands Associated Diseases Nombre Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Configuración Aceptar todo Rechazar
Shall we send you a message when we have discounts available?
Remind me later Permitir
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.