224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | P2X purinoceptor 7 |
|---|
Gene and Protein Information
| Gene ID | 5027 |
|---|---|
| Uniprot Accession IDs | Q99572 A8K2Z0 E7EMK6 F5H6P2 F5H7E8 F8W951 O14991 Q4VKH8 Q4VKH9 Q4VKI0 Q4VKI1 Q4VKI2 Q4VKI3 Q4VKI4 Q7Z771 Q96EV7 P2X7 |
| Ensembl ID | ENSP00000330696 |
| Symbol | P2X7 |
| Family | Belongs to the P2X receptor family. |
| Sequence | MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCPEYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVYEGNQKTCEVSAWCPIEAVEEAPRPALLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGDNFSDVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 699455 | P2RX7 | purinergic receptor P2X 7 | 9544 | Inparanoid, OMA | |
| Mouse | 18439 | P2rx7 | purinergic receptor P2X, ligand-gated ion channel, 7 | 10090 | MGI:1339957 | Inparanoid, OMA |
| Rat | 29665 | P2rx7 | purinergic receptor P2X 7 | 10116 | RGD:3241 | Inparanoid, OMA |
| Dog | 448778 | P2RX7 | purinergic receptor P2X 7 | 9615 | VGNC:44212 | Inparanoid, OMA |
| Horse | 100058464 | P2RX7 | purinergic receptor P2X 7 | 9796 | VGNC:21108 | Inparanoid, OMA |
| Cow | 286814 | P2RX7 | purinergic receptor P2X 7 | 9913 | VGNC:32522 | Inparanoid, OMA |
| Pig | P2RX7 | purinergic receptor P2X 7 [Source:HGNC Symbol;Acc:HGNC:8537] | 9823 | Inparanoid, OMA | ||
| Chicken | 771952 | P2RX7 | purinergic receptor P2X 7 | 9031 | CGNC:2831 | Inparanoid, OMA |
| Anole lizard | 100561255 | p2rx7 | purinergic receptor P2X 7 | 28377 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / Ion channel / ATP-gated p2x receptor cation channel (p2x receptor) family / P2X purinoceptor 7
protein / Ion channel / ATP-gated p2x receptor cation channel (p2x receptor) family / P2X purinoceptor 7
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.