P2RX7

DescripciónP2X purinoceptor 7

Gene and Protein Information

Gene ID5027
Uniprot Accession IDs Q99572 A8K2Z0 E7EMK6 F5H6P2 F5H7E8 F8W951 O14991 Q4VKH8 Q4VKH9 Q4VKI0 Q4VKI1 Q4VKI2 Q4VKI3 Q4VKI4 Q7Z771 Q96EV7 P2X7
Ensembl ID ENSP00000330696
Symbol P2X7
FamilyBelongs to the P2X receptor family.
Sequence
MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCPEYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVYEGNQKTCEVSAWCPIEAVEEAPRPALLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGDNFSDVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque699455P2RX7purinergic receptor P2X 79544Inparanoid, OMA
Mouse18439P2rx7purinergic receptor P2X, ligand-gated ion channel, 710090MGI:1339957Inparanoid, OMA
Rat29665P2rx7purinergic receptor P2X 710116RGD:3241Inparanoid, OMA
Dog448778P2RX7purinergic receptor P2X 79615VGNC:44212Inparanoid, OMA
Horse100058464P2RX7purinergic receptor P2X 79796VGNC:21108Inparanoid, OMA
Cow286814P2RX7purinergic receptor P2X 79913VGNC:32522Inparanoid, OMA
PigP2RX7purinergic receptor P2X 7 [Source:HGNC Symbol;Acc:HGNC:8537]9823Inparanoid, OMA
Chicken771952P2RX7purinergic receptor P2X 79031CGNC:2831Inparanoid, OMA
Anole lizard100561255p2rx7purinergic receptor P2X 728377Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Ion channel    /    ATP-gated p2x receptor cation channel (p2x receptor) family    /    P2X purinoceptor 7

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.