🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

P2RY1

DescripciónP2Y purinoceptor 1

Gene and Protein Information

Gene ID5028
Uniprot Accession IDs P47900 P2Y1
Ensembl ID ENSP00000304767
Symbol P2Y1 SARCC
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVVVAISPILFYSGTGVRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLIVRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp470970P2RY1purinergic receptor P2Y19598VGNC:12119OMA, EggNOG
Macaque708507P2RY1purinergic receptor P2Y19544Inparanoid, OMA, EggNOG
Mouse18441P2ry1purinergic receptor P2Y, G-protein coupled 110090MGI:105049Inparanoid, OMA, EggNOG
Rat25265P2ry1purinergic receptor P2Y110116RGD:3242Inparanoid, OMA, EggNOG
Dog449621P2RY1purinergic receptor P2Y19615VGNC:44213Inparanoid, OMA, EggNOG
Horse100055494P2RY1purinergic receptor P2Y19796VGNC:21109Inparanoid, OMA, EggNOG
Cow281963P2RY1purinergic receptor P2Y19913VGNC:32523Inparanoid, OMA, EggNOG
Pig503666P2RY1purinergic receptor P2Y19823Inparanoid, OMA, EggNOG
Opossum100020509P2RY1purinergic receptor P2Y113616Inparanoid, OMA, EggNOG
Platypus100080337P2RY1purinergic receptor P2Y19258Inparanoid, OMA, EggNOG
Chicken396275P2RY1purinergic receptor P2Y19031CGNC:49730Inparanoid, OMA, EggNOG
Anole lizard100558926p2ry1purinergic receptor P2Y128377Inparanoid, OMA, EggNOG
Xenopus100124773p2ry1purinergic receptor P2Y, G-protein coupled, 18364XB-GENE-1000145Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Purinoceptor    /    P2Y receptor    /    P2y purinoceptor 1

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.