🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

PLA2G5

DescripciónCalcium-dependent phospholipase A2

Gene and Protein Information

Gene ID5322
Uniprot Accession IDs P39877 Q8N435
Ensembl ID ENSP00000364249
Symbol FRFB GV-PLA2 PLA2-10 hVPLA(2)
FamilyBelongs to the phospholipase A2 family.
Sequence
MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp456588PLA2G5phospholipase A2 group V9598VGNC:9883OMA, EggNOG
Mouse18784Pla2g5phospholipase A2, group V10090MGI:101899Inparanoid, OMA, EggNOG
Rat29354Pla2g5phospholipase A2, group V10116RGD:62051Inparanoid, OMA, EggNOG
Dog478207PLA2G5phospholipase A2 group V9615VGNC:44630Inparanoid, OMA, EggNOG
Horse100058536PLA2G5phospholipase A2 group V9796VGNC:21517Inparanoid, OMA, EggNOG
Cow614911PLA2G5phospholipase A2 group V9913VGNC:32963Inparanoid, OMA, EggNOG
Chicken771655PLA2G5phospholipase A2 group V9031CGNC:56947OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    phospholipase    /    Calcium-dependent phospholipase A2
DTO Classes
protein    /    Enzyme    /    Hydrolase    /    Lipase    /    Phospholipase    /    Calcium-dependent phospholipase A2

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.