224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | DNA replication complex GINS protein PSF1 |
|---|
Gene and Protein Information
| Gene ID | 9837 |
|---|---|
| Uniprot Accession IDs | Q14691 Q9NQE2 Q9NQI7 |
| Ensembl ID | ENSP00000262460 |
| Symbol | KIAA0186 PSF1 PSF1 IMD55 |
| Family | Belongs to the GINS1/PSF1 family. |
| Sequence | MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 716398 | GINS1 | GINS complex subunit 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 69270 | Gins1 | GINS complex subunit 1 (Psf1 homolog) | 10090 | MGI:1916520 | Inparanoid, OMA, EggNOG |
| Rat | 499914 | Gins1 | GINS complex subunit 1 | 10116 | RGD:1562246 | Inparanoid, OMA, EggNOG |
| Horse | 100057209 | GINS1 | GINS complex subunit 1 | 9796 | VGNC:18342 | Inparanoid, OMA, EggNOG |
| Cow | 523427 | GINS1 | GINS complex subunit 1 | 9913 | VGNC:29360 | Inparanoid, OMA, EggNOG |
| Opossum | 100033223 | GINS1 | GINS complex subunit 1 | 13616 | Inparanoid, EggNOG | |
| Anole lizard | 100557866 | gins1 | GINS complex subunit 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 548918 | gins1 | GINS complex subunit 1 (Psf1 homolog) | 8364 | XB-GENE-5842214 | Inparanoid, OMA, EggNOG |
| Zebrafish | 450061 | gins1 | GINS complex subunit 1 (Psf1 homolog) | 7955 | ZDB-GENE-041010-184 | Inparanoid, OMA, EggNOG |
| C. elegans | 187885 | psf-1 | Probable DNA replication complex GINS protein PSF1 | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 38136 | Psf1 | CG9187 gene product from transcript CG9187-RA | 7227 | FBgn0035194 | Inparanoid, EggNOG |
| S.cerevisiae | 851576 | PSF1 | DNA replication protein PSF1 | 4932 | S000002420 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.