224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Homeobox protein OTX1 |
|---|
Gene and Protein Information
| Gene ID | 5013 |
|---|---|
| Uniprot Accession IDs | P32242 A6NHA2 B3KTJ4 Q53TG6 |
| Ensembl ID | ENSP00000282549 |
| Family | Belongs to the paired homeobox family. Bicoid subfamily. |
| Sequence | MMSYLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVRESSGSESSGQFTPPAVSSSASSSSSASSSSANPAAAAAAGLGGNPVAAASSLSTPAASSIWSPASISPGSAPASVSVPEPLAAPSNTSCMQRSVAAGAATAAASYPMSYGQGGSYGQGYPTPSSSYFGGVDCSSYLAPMHSHHHPHQLSPMAPSSMAGHHHHHPHAHHPLSQSSGHHHHHHHHHHQGYGGSGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASWRFQVL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 744025 | OTX1 | orthodenticle homeobox 1 | 9598 | VGNC:50339 | OMA, EggNOG |
| Macaque | 694175 | OTX1 | orthodenticle homeobox 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 18423 | Otx1 | orthodenticle homeobox 1 | 10090 | MGI:97450 | Inparanoid, OMA, EggNOG |
| Rat | 25646 | Otx1 | orthodenticle homeobox 1 | 10116 | RGD:3237 | Inparanoid, OMA |
| Dog | 610347 | OTX1 | orthodenticle homeobox 1 | 9615 | VGNC:44193 | Inparanoid, OMA, EggNOG |
| Horse | 100051685 | OTX1 | orthodenticle homeobox 1 | 9796 | VGNC:21094 | Inparanoid, OMA, EggNOG |
| Cow | 540628 | OTX1 | orthodenticle homeobox 1 | 9913 | VGNC:32502 | Inparanoid, OMA, EggNOG |
| Opossum | 100031880 | OTX1 | orthodenticle homeobox 1 | 13616 | Inparanoid, EggNOG | |
| Anole lizard | OTX1 | orthodenticle homeobox 1 [Source:HGNC Symbol;Acc:HGNC:8521] | 28377 | Inparanoid, OMA | ||
| Zebrafish | 30500 | otx1 | orthodenticle homeobox 1 | 7955 | ZDB-GENE-980526-400 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.