🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CDCA5

DescripciónSororin

Gene and Protein Information

Gene ID113130
Uniprot Accession IDs Q96FF9 A8K625
Ensembl ID ENSP00000275517
Symbol SORORIN
FamilyBelongs to the sororin family.
Sequence
MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp451310CDCA5cell division cycle associated 59598VGNC:11291OMA, EggNOG
Macaque721998CDCA5cell division cycle associated 59544Inparanoid, EggNOG
Mouse67849Cdca5cell division cycle associated 510090MGI:1915099Inparanoid, OMA, EggNOG
Rat684771Cdca5cell division cycle associated 510116RGD:1560863Inparanoid, EggNOG
Dog612071CDCA5cell division cycle associated 59615VGNC:39015Inparanoid, OMA, EggNOG
Horse100050887CDCA5cell division cycle associated 59796VGNC:16311Inparanoid, OMA, EggNOG
Cow613318CDCA5cell division cycle associated 59913Inparanoid, EggNOG
Xenopus100145078cdca5cell division cycle associated 58364XB-GENE-5908127Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.