224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Putative P2Y purinoceptor 10 |
|---|
Gene and Protein Information
| Gene ID | 27334 |
|---|---|
| Uniprot Accession IDs | O00398 D3DTE5 Q4VBN7 Q86V16 P2Y10 |
| Ensembl ID | ENSP00000171757 |
| Symbol | P2Y10 LYPSR2 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYASICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 78826 | P2ry10 | purinergic receptor P2Y, G-protein coupled 10 | 10090 | MGI:1926076 | Inparanoid, OMA |
| Rat | 317219 | P2ry10 | P2Y receptor family member 10 | 10116 | RGD:1561912 | Inparanoid, OMA, EggNOG |
| Dog | 491980 | P2RY10 | P2Y receptor family member 10 | 9615 | VGNC:49748 | Inparanoid, OMA, EggNOG |
| Horse | 100072611 | LOC100072611 | putative P2Y purinoceptor 10 | 9796 | OMA, EggNOG | |
| Cow | 515172 | P2RY10 | P2Y receptor family member 10 | 9913 | VGNC:32524 | Inparanoid, OMA, EggNOG |
| Pig | 100157702 | P2RY10 | P2Y receptor family member 10 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100020339 | LOC100020339 | putative P2Y purinoceptor 10 | 13616 | OMA, EggNOG | |
| Chicken | 422147 | P2RY10 | purinergic receptor P2Y10 | 9031 | CGNC:51633 | OMA, EggNOG |
| Anole lizard | 100562253 | LOC100562253 | putative P2Y purinoceptor 10 | 28377 | OMA, EggNOG | |
| Xenopus | 100495529 | p2ry10 | P2Y receptor family member 10 | 8364 | XB-GENE-967610 | Inparanoid, OMA, EggNOG |
| Zebrafish | 100037375 | p2ry10 | P2Y receptor family member 10 | 7955 | ZDB-GENE-070410-105 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Purinoceptor / P2Y receptor / Putative P2Y purinoceptor 10
protein / G-protein coupled receptor / Class A rhodopsin like / Purinoceptor / P2Y receptor / Putative P2Y purinoceptor 10
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.