224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Peroxisomal coenzyme A diphosphatase NUDT7 |
|---|
Gene and Protein Information
| Gene ID | 283927 |
|---|---|
| Uniprot Accession IDs | P0C024 B4DLE5 H3BUB8 |
| Ensembl ID | ENSP00000268533 |
| Family | Belongs to the Nudix hydrolase family. PCD1 subfamily. |
| Sequence | MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGEVCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTLITPFVGLIDHNFQAQPNPAEVKDVFLVPLAYFLHPQVHDQHYVTRLGHRFINHIFEYTNPEDGVTYQIKGMTANLAVLVAFIILEKKPTFEVQFNLNDVLASSEELFLKVHKKATSRL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 454256 | NUDT7 | nudix hydrolase 7 | 9598 | VGNC:5858 | OMA, EggNOG |
| Macaque | 715443 | NUDT7 | nudix hydrolase 7 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 67528 | Nudt7 | nudix (nucleoside diphosphate linked moiety X)-type motif 7 | 10090 | MGI:1914778 | Inparanoid, OMA, EggNOG |
| Rat | 361413 | Nudt7 | nudix hydrolase 7 | 10116 | RGD:1306719 | Inparanoid, OMA, EggNOG |
| Dog | 489703 | NUDT7 | nudix hydrolase 7 | 9615 | VGNC:44035 | Inparanoid, OMA, EggNOG |
| Horse | 100069343 | NUDT7 | nudix hydrolase 7 | 9796 | VGNC:20951 | Inparanoid, OMA, EggNOG |
| Cow | 504826 | NUDT7 | nudix hydrolase 7 | 9913 | VGNC:32341 | Inparanoid, OMA, EggNOG |
| Opossum | 100014208 | NUDT7 | nudix hydrolase 7 | 13616 | Inparanoid, EggNOG | |
| Anole lizard | 100555561 | nudt7 | nudix hydrolase 7 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | nudt7 | nudix hydrolase 7 [Source:Xenbase;Acc:XB-GENE-966296] | 8364 | OMA, EggNOG | ||
| Zebrafish | 100329471 | nudt7 | nudix (nucleoside diphosphate linked moiety X)-type motif 7 | 7955 | ZDB-GENE-131127-212 | OMA, EggNOG |
| C. elegans | 190780 | ndx-8 | Peroxisomal coenzyme A diphosphatase ndx-8 | 6239 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.