224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Proteasome activator complex subunit 1 |
|---|
Gene and Protein Information
| Gene ID | 5720 |
|---|---|
| Uniprot Accession IDs | Q06323 A6NJG9 H0YNE3 Q6IBM2 Q9UEF4 |
| Ensembl ID | ENSP00000372155 |
| Symbol | IFI5111 PA28A IFI5111 REGalpha PA28alpha HEL-S-129m |
| Family | Belongs to the PA28 family. |
| Sequence | MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 452809 | PSME1 | proteasome activator subunit 1 | 9598 | VGNC:3334 | OMA, EggNOG |
| Macaque | 714364 | PSME1 | proteasome activator subunit 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 19186 | Psme1 | proteasome (prosome, macropain) activator subunit 1 (PA28 alpha) | 10090 | MGI:1096367 | Inparanoid, OMA, EggNOG |
| Rat | 29630 | Psme1 | proteasome activator subunit 1 | 10116 | RGD:3429 | Inparanoid, OMA, EggNOG |
| Dog | 480256 | PSME1 | proteasome activator subunit 1 | 9615 | VGNC:45116 | Inparanoid, OMA, EggNOG |
| Cow | 510041 | PSME1 | proteasome activator subunit 1 | 9913 | VGNC:33473 | Inparanoid, OMA, EggNOG |
| Pig | 397572 | PSME1 | proteasome activator subunit 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100025042 | PSME1 | proteasome activator subunit 1 | 13616 | Inparanoid, EggNOG | |
| Anole lizard | 100557206 | LOC100557206 | proteasome activator complex subunit 1 | 28377 | OMA, EggNOG | |
| Xenopus | 496755 | psme1 | proteasome activator subunit 1 | 8364 | XB-GENE-974277 | Inparanoid, OMA, EggNOG |
| Zebrafish | 30648 | psme1 | proteasome activator subunit 1 | 7955 | ZDB-GENE-991110-17 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.