224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Olfactory receptor 1C1 |
|---|
Gene and Protein Information
| Gene ID | 26188 |
|---|---|
| Uniprot Accession IDs | Q15619 B9EIR9 Q5VVD2 Q6IF97 Q8NGZ1 Q96R83 |
| Ensembl ID | ENSP00000386138 |
| Symbol | OR1-42 ORL211 TPCR27 HSTPCR27 OR1.5.10 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MEKRNLTVVREFVLLGLPSSAEQQHLLSVLFLCMYLATTLGNMLIIATIGFDSHLHSPMYFFLSNLAFVDICFTSTTVPQMVVNILTGTKTISFAGCLTQLFFFVSFVNMDSLLLCVMAYDRYVAICHPLHYTARMNLCLCVQLVAGLWLVTYLHALLHTVLIAQLSFCASNIIHHFFCDLNPLLQLSCSDVSFNVMIIFAVGGLLALTPLVCILVSYGLIFSTVLKITSTQGKQRAVSTCSCHLSVVVLFYGTAIAVYFSPSSPHMPESDTLSTIMYSMVAPMLNPFIYTLRNRDMKRGLQKMLLKCTVFQQQ Show more |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Olfactory receptor / Olfactory receptor 1C1
protein / G-protein coupled receptor / Class A rhodopsin like / Olfactory receptor / Olfactory receptor 1C1
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.