PPP1R7

DescripciónProtein phosphatase 1 regulatory subunit 7

Gene and Protein Information

Gene ID5510
Uniprot Accession IDs Q15435 B4DFD4 B5MCY6 Q9UQE5 Q9UQE6 Q9Y6K4
Ensembl ID ENSP00000234038
Symbol SDS22 SDS22
FamilyBelongs to the SDS22 family.
Sequence
MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPEEEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp460079PPP1R7protein phosphatase 1 regulatory subunit 79598VGNC:14345OMA, EggNOG
Macaque700574PPP1R7protein phosphatase 1 regulatory subunit 79544Inparanoid, OMA, EggNOG
Mouse66385Ppp1r7protein phosphatase 1, regulatory (inhibitor) subunit 710090MGI:1913635Inparanoid, OMA, EggNOG
Dog100855698PPP1R7protein phosphatase 1 regulatory subunit 79615Inparanoid, OMA
Horse100067637PPP1R7protein phosphatase 1 regulatory subunit 79796VGNC:52421Inparanoid, OMA, EggNOG
Cow505297PPP1R7protein phosphatase 1 regulatory subunit 79913VGNC:52808Inparanoid, OMA, EggNOG
Pig100511842PPP1R7protein phosphatase 1 regulatory subunit 79823Inparanoid, OMA, EggNOG
Platypus100082676PPP1R7protein phosphatase 1 regulatory subunit 79258Inparanoid, OMA, EggNOG
Anole lizard100552255ppp1r7protein phosphatase 1 regulatory subunit 728377Inparanoid, OMA, EggNOG
Xenopus448394ppp1r7protein phosphatase 1 regulatory subunit 78364XB-GENE-964679Inparanoid, OMA, EggNOG
Zebrafish560323ppp1r7protein phosphatase 1, regulatory (inhibitor) subunit 77955ZDB-GENE-051113-288Inparanoid, OMA, EggNOG
C. elegans174266sds-22Protein phosphatase 1 regulatory subunit SDS22 homolog6239Inparanoid, OMA
Fruitfly42091sds22CG5851 gene product from transcript CG5851-RA7227FBgn0028992Inparanoid, EggNOG
S.cerevisiae853641SDS22type 1 protein phosphatase-activating protein SDS224932S000001676Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.