🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

SLC10A1

DescripciónSodium/bile acid cotransporter

Gene and Protein Information

Gene ID6554
Uniprot Accession IDs Q14973 B9EGB6 Q2TU29
Ensembl ID ENSP00000216540
Symbol NTCP NTCP
FamilyBelongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family.
Sequence
MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp453001SLC10A1solute carrier family 10 member 19598VGNC:8206OMA, EggNOG
Macaque712925SLC10A1solute carrier family 10 member 19544Inparanoid, OMA, EggNOG
Mouse20493Slc10a1solute carrier family 10 (sodium/bile acid cotransporter family), member 110090MGI:97379Inparanoid, OMA, EggNOG
Rat24777Slc10a1solute carrier family 10 member 110116RGD:3681Inparanoid, OMA, EggNOG
Dog480372SLC10A1solute carrier family 10 member 19615VGNC:46211Inparanoid, OMA, EggNOG
Horse100064290SLC10A1solute carrier family 10 member 19796VGNC:23011Inparanoid, OMA, EggNOG
Cow532890SLC10A1solute carrier family 10 member 19913VGNC:34659Inparanoid, OMA, EggNOG
Pig100153302SLC10A1solute carrier family 10 member 19823OMA, EggNOG
Opossum100028851SLC10A1solute carrier family 10 member 113616Inparanoid, EggNOG
Anole lizardSLC10A1solute carrier family 10 member 1 [Source:HGNC Symbol;Acc:HGNC:10905]28377Inparanoid, OMA, EggNOG
XenopusSLC10A1solute carrier family 10 member 1 [Source:HGNC Symbol;Acc:HGNC:10905]8364OMA, EggNOG
Zebrafish562260slc10a1solute carrier family 10 (sodium/bile acid cotransporter), member 17955ZDB-GENE-041001-190Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transporter    /    cation transporter    /    Sodium/bile acid cotransporter
DTO Classes
protein    /    Transporter    /    SLC superfamily of solute carriers    /    SLC10 family of sodium-bile acid co-transporters    /    Sodium/bile acid cotransporter

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.