224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | N-myc-interactor |
|---|
Gene and Protein Information
| Gene ID | 9111 |
|---|---|
| Uniprot Accession IDs | Q13287 B5BU69 Q53TI8 Q8WTW2 Q9BVE5 Nmi |
| Ensembl ID | ENSP00000243346 |
| Family | Belongs to the NMI family. |
| Sequence | MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVSMSKHHVQIKDVNLEVTAKPVPLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVADKILKKKEYPLYINQTCHRVTVSPYTEIHLKKYQIFSGTSKRTVLLTGMEGIQMDEEIVEDLINIHFQRAKNGGGEVDVVKCSLGQPHIAYFEE Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 470714 | NMI | N-myc and STAT interactor | 9598 | VGNC:2713 | OMA, EggNOG |
| Macaque | 694554 | NMI | N-myc and STAT interactor | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 64685 | Nmi | N-myc (and STAT) interactor | 10090 | MGI:1928368 | Inparanoid, OMA, EggNOG |
| Rat | 311021 | Nmi | N-myc (and STAT) interactor | 10116 | RGD:1311721 | Inparanoid, OMA |
| Dog | 476146 | NMI | N-myc and STAT interactor | 9615 | VGNC:43861 | Inparanoid, OMA, EggNOG |
| Horse | 100050154 | NMI | N-myc and STAT interactor | 9796 | VGNC:20779 | Inparanoid, OMA, EggNOG |
| Cow | 511280 | NMI | N-myc and STAT interactor | 9913 | OMA, EggNOG | |
| Pig | 100621233 | NMI | N-myc and STAT interactor | 9823 | OMA, EggNOG | |
| Opossum | 100019843 | NMI | N-myc and STAT interactor | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 424314 | NMI | N-myc and STAT interactor | 9031 | CGNC:9480 | Inparanoid, OMA, EggNOG |
| Anole lizard | NMI | N-myc and STAT interactor [Source:HGNC Symbol;Acc:HGNC:7854] | 28377 | Inparanoid, OMA, EggNOG | ||
| Xenopus | 613094 | nmi | N-myc and STAT interactor | 8364 | XB-GENE-492655 | Inparanoid, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.