NEU4

DescripciónSialidase-4

Gene and Protein Information

Gene ID129807
Uniprot Accession IDs Q8WWR8 A8K056 J3KNJ5 Q96D64
Ensembl ID ENSP00000320318
FamilyBelongs to the glycosyl hydrolase 33 family.
Sequence
MGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPDDSHAHRLVLRRGTLAGGSVRWGALHVLGTAALAEHRSMNPCPVHDAGTGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQLPSGRLLVPAYTYRVDRRECFGKICRTSPHSFAFYSDDHGRTWRCGGLVPNLRSGECQLAAVDGGQAGSFLYCNARSPLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSIVGFPAPAPNRPRDDSWSVGPGSPLQPPLLGPGVHEPPEEAAVDPRGGQVPGGPFSRLQPRGDGPRQPGPRPGVSGDVGSWTLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTEPWVIYEGPSGYSDLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNLGDKPRGCCWPS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque702264NEU4neuraminidase 49544Inparanoid, OMA, EggNOG
Mouse241159Neu4sialidase 410090MGI:2661364Inparanoid, OMA, EggNOG
Rat316642Neu4neuraminidase 410116RGD:1308624Inparanoid, OMA, EggNOG
Cow528030NEU4neuraminidase 49913VGNC:50074Inparanoid, OMA
Opossum103106800NEU4neuraminidase 413616Inparanoid, OMA
Anole lizard100560635neu4neuraminidase 428377Inparanoid, OMA
Zebrafish553569neu4sialidase 47955ZDB-GENE-050522-125Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.