224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit |
|---|
Gene and Protein Information
| Gene ID | 5499 |
|---|---|
| Uniprot Accession IDs | P62136 A6NNR3 B2R908 P08129 P20653 P22802 Q07161 PP-1A |
| Ensembl ID | ENSP00000326031 |
| Symbol | PPP1A PP1A PP-1A PPP1A PP1alpha |
| Family | Belongs to the PPP phosphatase family. PP-1 subfamily. |
| Sequence | MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 745709 | PPP1CA | protein phosphatase 1 catalytic subunit alpha | 9598 | VGNC:13321 | OMA, EggNOG |
| Macaque | 721735 | PPP1CA | protein phosphatase 1 catalytic subunit alpha | 9544 | Inparanoid, OMA | |
| Mouse | 19045 | Ppp1ca | protein phosphatase 1, catalytic subunit, alpha isoform | 10090 | MGI:103016 | Inparanoid, OMA |
| Rat | 24668 | Ppp1ca | protein phosphatase 1 catalytic subunit alpha | 10116 | RGD:3375 | Inparanoid, OMA, EggNOG |
| Horse | 100059233 | PPP1CA | protein phosphatase 1 catalytic subunit alpha | 9796 | VGNC:49522 | Inparanoid, OMA, EggNOG |
| Cow | 516175 | PPP1CA | protein phosphatase 1 catalytic subunit alpha | 9913 | Inparanoid, OMA | |
| Pig | 733611 | PPP1CA | protein phosphatase 1 catalytic subunit alpha | 9823 | OMA, EggNOG | |
| Anole lizard | 100558590 | ppp1ca | protein phosphatase 1 catalytic subunit alpha | 28377 | Inparanoid, OMA | |
| C. elegans | 3564807 | gsp-2 | Serine/threonine-protein phosphatase PP1-beta | 6239 | Inparanoid, OMA | |
| Fruitfly | 49260 | Pp1-87B | Protein phosphatase 1 at 87B | 7227 | FBgn0004103 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.