224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Neuroserpin |
|---|
Gene and Protein Information
| Gene ID | 5274 |
|---|---|
| Uniprot Accession IDs | Q99574 A8K217 D3DNP1 Q6AHZ4 |
| Ensembl ID | ENSP00000295777 |
| Symbol | PI12 PI12 neuroserpin |
| Family | Belongs to the serpin family. |
| Sequence | MAFLGLFSLLVLQSMATGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 460834 | SERPINI1 | serpin family I member 1 | 9598 | VGNC:10044 | OMA, EggNOG |
| Macaque | 699483 | SERPINI1 | serpin family I member 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 20713 | Serpini1 | serine (or cysteine) peptidase inhibitor, clade I, member 1 | 10090 | MGI:1194506 | Inparanoid, OMA, EggNOG |
| Rat | 116459 | Serpini1 | serpin family I member 1 | 10116 | RGD:619896 | Inparanoid, OMA, EggNOG |
| Dog | 478684 | SERPINI1 | serpin family I member 1 | 9615 | VGNC:46042 | Inparanoid, OMA, EggNOG |
| Horse | 100057410 | SERPINI1 | serpin family I member 1 | 9796 | VGNC:22863 | Inparanoid, OMA, EggNOG |
| Cow | 509976 | SERPINI1 | serpin family I member 1 | 9913 | VGNC:34481 | Inparanoid, OMA, EggNOG |
| Pig | 100154352 | SERPINI1 | serpin family I member 1 | 9823 | OMA, EggNOG | |
| Opossum | 100010617 | SERPINI1 | serpin family I member 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100073875 | SERPINI1 | serpin family I member 1 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 425002 | SERPINI1 | serpin family I member 1 | 9031 | CGNC:7200 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100552314 | serpini1 | serpin family I member 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100144746 | serpini1 | serpin family I member 1 | 8364 | XB-GENE-948443 | Inparanoid, OMA, EggNOG |
| Zebrafish | 557627 | serpini1 | serpin peptidase inhibitor, clade I (neuroserpin), member 1 | 7955 | ZDB-GENE-060503-390 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / Enzyme modulator / Protease inhibitor / Serine protease inhibitor / Neuroserpin
protein / Enzyme modulator / Protease inhibitor / Serine protease inhibitor / Neuroserpin
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.