🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

NPC2

DescripciónNPC intracellular cholesterol transporter 2

Gene and Protein Information

Gene ID10577
Uniprot Accession IDs P61916 B4DQV7 Q15668 Q29413
Ensembl ID ENSP00000451112
Symbol HE1 HE1 EDDM1
FamilyBelongs to the NPC2 family.
Sequence
MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp450192NPC2NPC intracellular cholesterol transporter 29598VGNC:10310Inparanoid, OMA, EggNOG
Macaque699881NPC2NPC intracellular cholesterol transporter 29544Inparanoid, OMA, EggNOG
Mouse67963Npc2NPC intracellular cholesterol transporter 210090MGI:1915213Inparanoid, OMA, EggNOG
Rat286898Npc2NPC intracellular cholesterol transporter 210116RGD:628756Inparanoid, OMA, EggNOG
Dog403920NPC2NPC intracellular cholesterol transporter 29615VGNC:43914Inparanoid, OMA, EggNOG
Horse100051060NPC2NPC intracellular cholesterol transporter 29796VGNC:20833Inparanoid, OMA, EggNOG
Cow280815NPC2NPC intracellular cholesterol transporter 29913VGNC:32196Inparanoid, OMA, EggNOG
Pig397410NPC2NPC intracellular cholesterol transporter 29823Inparanoid, OMA, EggNOG
Opossum100023837NPC2NPC intracellular cholesterol transporter 213616Inparanoid, EggNOG
Chicken423353NPC2Niemann-Pick disease, type C29031CGNC:7790Inparanoid, OMA
Anole lizard100557536npc2NPC intracellular cholesterol transporter 228377Inparanoid, OMA, EggNOG
Xenopus493351npc2Niemann-Pick disease, type C28364XB-GENE-6258064Inparanoid, OMA, EggNOG
Zebrafish282673npc2Niemann-Pick disease, type C27955ZDB-GENE-021206-13Inparanoid, OMA, EggNOG
Fruitfly33374Npc2aNiemann-Pick type C-2a7227FBgn0031381Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.