🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

NPY1R

DescripciónNeuropeptide Y receptor type 1

Gene and Protein Information

Gene ID4886
Uniprot Accession IDs P25929 B2R6H5 NPY1-R
Ensembl ID ENSP00000354652
Symbol NPYR NPYY1 NPYR NPY1-R
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp471331NPY1Rneuropeptide Y receptor Y19598VGNC:648OMA, EggNOG
Macaque574206NPY1Rneuropeptide Y receptor Y19544Inparanoid, OMA, EggNOG
Mouse18166Npy1rneuropeptide Y receptor Y110090MGI:104963Inparanoid, OMA, EggNOG
Rat29358Npy1rneuropeptide Y receptor Y110116RGD:3198Inparanoid, OMA, EggNOG
Dog399518NPY1Rneuropeptide Y receptor Y19615VGNC:43937Inparanoid, OMA, EggNOG
Horse100061686NPY1Rneuropeptide Y receptor Y19796VGNC:20853Inparanoid, OMA, EggNOG
Cow504813NPY1Rneuropeptide Y receptor Y19913VGNC:32223Inparanoid, OMA, EggNOG
Pig397547NPY1Rneuropeptide Y receptor Y19823Inparanoid, OMA, EggNOG
Opossum100022417NPY1Rneuropeptide Y receptor Y113616Inparanoid, OMA, EggNOG
Chicken428727NPY1Rneuropeptide Y receptor Y19031CGNC:53446Inparanoid, OMA
Anole lizard100561643npy1rneuropeptide Y receptor Y128377Inparanoid, OMA
Zebrafish793668npy1rneuropeptide Y receptor Y17955ZDB-GENE-080221-1Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Neuropeptide Y receptor    /    Neuropeptide y receptor type 1

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.