🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

IL23A

DescripciónInterleukin-23 subunit alpha

Gene and Protein Information

Gene ID51561
Uniprot Accession IDs Q9NPF7 Q6NZ80 Q6NZ82 Q9H2A5 IL-23 subunit alpha
Ensembl ID ENSP00000228534
Symbol SGRF P19 SGRF IL-23 IL-23A IL23P19
FamilyBelongs to the IL-6 superfamily.
Sequence
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp467036IL23Ainterleukin 23 subunit alpha9598VGNC:8422OMA, EggNOG
Macaque712627IL23Ainterleukin 23 subunit alpha9544Inparanoid, OMA, EggNOG
Mouse83430Il23ainterleukin 23, alpha subunit p1910090MGI:1932410Inparanoid, OMA, EggNOG
Rat155140Il23ainterleukin 23 subunit alpha10116RGD:620873Inparanoid, OMA, EggNOG
Dog481110IL23Ainterleukin 23 subunit alpha9615VGNC:41972Inparanoid, OMA, EggNOG
Horse100034230IL23Ainterleukin 23 subunit alpha9796VGNC:19021Inparanoid, OMA, EggNOG
Cow511022IL23Ainterleukin 23 subunit alpha9913VGNC:30146Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    interleukin superfamily    /    Interleukin-23 subunit alpha
DTO Classes
protein    /    Signaling    /    Cytokine    /    Interleukin superfamily    /    Interleukin-23 subunit alpha

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.