IL7

DescripciónInterleukin-7

Gene and Protein Information

Gene ID3574
Uniprot Accession IDs P13232 A0N0L3 Q5FBY5 Q5FBY9 IL-7
Ensembl ID ENSP00000263851
Symbol IL-7
FamilyBelongs to the IL-7/IL-9 family.
Sequence
MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp464245IL7interleukin 79598VGNC:862OMA, EggNOG
Macaque574168IL7interleukin 79544OMA, EggNOG
Mouse16196Il7interleukin 710090MGI:96561Inparanoid, OMA, EggNOG
Rat25647Il7interleukin 710116RGD:2904Inparanoid, OMA, EggNOG
Dog751768IL7interleukin 79615VGNC:41995Inparanoid, OMA, EggNOG
Horse100059131IL7interleukin 79796VGNC:19037Inparanoid, OMA, EggNOG
Cow280827IL7interleukin 79913VGNC:30169Inparanoid, OMA, EggNOG
Pig397253IL7interleukin 79823Inparanoid, OMA, EggNOG
Opossum103106447IL7interleukin 713616Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.